Fwd: [Genbank-bb] Change to sequence display formats : Removal of GIs by June 2016
"Fields, Christopher J" <[email protected]> Fri, 26 Jun 2015 23:46:19 +0000
| Newsgroups | gmane.comp.lang.perl.bio.general |
|---|---|
| Message-ID | <[email protected]> |
Something to keep in mind if parsing breaks (though we should be okay). I’m more concerned about BLAST+ XML changes... chris Begin forwarded message: From: "Cavanaugh, Mark (NIH/NLM/NCBI) [E]" <[email protected]<mailto:[email protected]>> To: "'[email protected]<mailto:[email protected]>' ([email protected]<mailto:[email protected]>)" <[email protected]<mailto:[email protected]>> Date: June 26, 2015 at 5:13:50 PM CDT Subject: [Genbank-bb] Change to sequence display formats : Removal of GIs by June 2016 Greetings GenBank Users, A very significant change which impacts the GenBank, GenPept, and FASTA display formats for sequence records at NCBI was announced in the June 2015 GenBank release notes : The removal of GI sequence identifiers. This change could have many impacts, so it seems prudent to announce it independently, to ensure that as many users are aware of the change as possible. So Section 1.4.1 of the June release notes are reproduced below. Mark Cavanaugh GenBank NCBI/NLM/NIH/HHS 1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats As of 06/15/2016, the integer sequence identifiers known as "GIs" will no longer be included in the GenBank, GenPept, and FASTA formats supported by NCBI for the display of sequence records. As first described in the Release Notes for GenBank 199.0 in December 2013, NCBI is in the process of moving to storage solutions which utilize only Accession.Version identifiers. See Section 1.4.2 of these release notes for additional background information about those developments. Although GI sequence identifiers served their purpose well for many years, the Accession.Version system is completely equivalent (and much more human-readable). And given the shift to non-GI-based systems, the importance of using Accession.Version identifiers cannot be overstated. So as an initial step, NCBI will cease the display of GI identifiers in the flatfile and FASTA views of all sequence records. Previously-assigned GI identifiers will continue to exist 'behind the scenes', and NCBI services (including URLs, APIs, etc) which accept GIs as inputs/arguments will be supported, for those sequence records that have GIs, for the foreseeable future. Over the next year NCBI will identify all such services that do not yet support Accession.Version identifiers, and add that support. Users of those services will then be encouraged to make use of Accession.Version rather than GIs. Of course, for those services that already support Accession.Version, NCBI encourages users to begin transitioning away from GI as soon as is practical. In the sample record below, nucleotide sequence AF123456 has been assigned a GI of 6633795, and the protein translation of its coding region feature has been assigned a GI of 6633796 : LOCUS AF123456 1510 bp mRNA linear VRT 12-APR-2012 DEFINITION Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds. ACCESSION AF123456 VERSION AF123456.2 GI:6633795 .... CDS <1..936 /gene="DMRT1" /note="cDMRT1" /codon_start=1 /product="doublesex and mab-3 related transcription factor 1" /protein_id="AAF19666.1" /db_xref="GI:6633796" /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE" After June 15 2016, the GI value on the VERSION line and the GI /db_xref qualifier for the coding region feature will no longer be displayed: LOCUS AF123456 1510 bp mRNA linear VRT 12-APR-2012 DEFINITION Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds. ACCESSION AF123456 VERSION AF123456.2 .... CDS <1..936 /gene="DMRT1" /note="cDMRT1" /codon_start=1 /product="doublesex and mab-3 related transcription factor 1" /protein_id="AAF19666.1" /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE" Similarly, the GI value will be removed from the VERSION line of the GenPept format. Currently: LOCUS AAF19666 311 aa linear VRT 12-APR-2012 DEFINITION doublesex and mab-3 related transcription factor 1, partial [Gallus gallus]. ACCESSION AAF19666 VERSION AAF19666.1 GI:6633796 DBSOURCE accession AF123456.2 .... CDS 1..311 /gene="DMRT1" /coded_by="AF123456.2:<1..936" As of 06/15/2016: LOCUS AAF19666 311 aa linear VRT 12-APR-2012 DEFINITION doublesex and mab-3 related transcription factor 1, partial [Gallus gallus]. ACCESSION AAF19666 VERSION AAF19666.1 DBSOURCE accession AF123456.2 .... CDS 1..311 /gene="DMRT1" /coded_by="AF123456.2:<1..936" Note that the coding region feature for GenPept format has never included the display of nucleotide GI values. For FASTA format, GI values will be removed from the FASTA header/defline: Currently: gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA [....] gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial [Gallus gallus] PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC LSSSESTKGDLECEPHQEPGAFAVSPVLEGE As of 06/15/2016: gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA [....] gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial [Gallus gallus] PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC LSSSESTKGDLECEPHQEPGAFAVSPVLEGE Please direct any inquiries about these changes to the NCBI Service Desk: [email protected]<mailto:[email protected]> _______________________________________________ Genbankb mailing list [email protected]<mailto:[email protected]> http://www.bio.net/biomail/listinfo/genbankb _______________________________________________ Bioperl-l mailing list [email protected] http://mailman.open-bio.org/mailman/listinfo/bioperl-l